DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Pdfr

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster


Alignment Length:479 Identity:95/479 - (19%)
Similarity:162/479 - (33%) Gaps:144/479 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LFPNGTLYVRERALMVQPSDYC-VDWEVAVVCLNDSQPINALEDPDYAANPLVQQEPP------- 189
            ||.|.||        .|...|| ..|: .::|.           |...|..|.:...|       
  Fly   203 LFVNYTL--------PQTGLYCNWTWD-TLLCW-----------PPTPAGVLARMNCPGGFHGVD 247

  Fly   190 --KASLRLSKCCGKWGSYNTQLQNCDLQPNHQAAVDGLLRLSPQLPEGSYQTSYGLPDCGQPGGY 252
              |.::|..:..|:|||          :||          .:...|.|  .|.||  .|.:|   
  Fly   248 TRKFAIRKCELDGRWGS----------RPN----------ATEVNPPG--WTDYG--PCYKP--- 285

  Fly   253 SIAGDWQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIA-CQHLFSSAAGAGIHDGSIG 316
                     ::.|  .|.|:..|:..|   .::..:|...::|:. |..||     |.|....|.
  Fly   286 ---------EIIR--LMQQMGSKDFDA---YIDIARRTRTLEIVGLCLSLF-----ALIVSLLIF 331

  Fly   317 GTIE--QANGQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHALHWRCQICYVTCLLFGKILL 379
            .|..  :.|...:.|.:....:|..|:.|:                      .|:.....|....
  Fly   332 CTFRSLRNNRTKIHKNLFVAMVLQVIIRLT----------------------LYLDQFRRGNKEA 374

  Fly   380 AIEELSSSLQPGSAACHTLAITMQFFFLAAFFWL--------NTMCFNIWWTFRDFRPSSLERNQ 436
            |.....|.::.....|....:.:::...|.|.|:        |.:...::              |
  Fly   375 ATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVF--------------Q 425

  Fly   437 EALRRYLYSLYAWGGPLLITFV-AACVDQLPETTLLRPGFGQLYC-WFDNRNLSIFAYFY---GP 496
            .:.....:|...|..|:|:|.| |.|.....:|:|     |:  | |    |.::..|::   ||
  Fly   426 GSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSL-----GE--CLW----NYNLTPYYWILEGP 479

  Fly   497 IGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALG-RVCLKLVVVMGVTWIADILSWLVGG 560
            ...::..|....|:....|...|  |....|..|::... |..:.|:.::|:|.:...|:.|...
  Fly   480 RLAVILLNFCFLVNIIRVLVMKL--RQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTA 542

  Fly   561 PH-GVWFF-TDLINALQGVFIFIV 582
            .: .||.: |..:.:.||.||.::
  Fly   543 TNFAVWSYGTHFLTSFQGFFIALI 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 49/265 (18%)
PdfrNP_001245501.1 HRM 213..272 CDD:280888 16/90 (18%)
7tm_4 306..563 CDD:304433 59/310 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.