Sequence 1: | NP_001285340.1 | Gene: | mthl1 / 32637 | FlyBaseID: | FBgn0030766 | Length: | 676 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_008770523.1 | Gene: | Adgrg5 / 307645 | RGDID: | 1305559 | Length: | 564 | Species: | Rattus norvegicus |
Alignment Length: | 365 | Identity: | 66/365 - (18%) |
---|---|---|---|
Similarity: | 113/365 - (30%) | Gaps: | 146/365 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 258 WQDAKLDRNTAML-------QLPHK---------NLS--------------------AGQY---- 282
Fly 283 -----CLEHTQREGEVKIIA-CQHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTGGILVSIV 341
Fly 342 FLSATLVAGFLLPAVH-HALHWRCQICYVTCLLFGKILL--AIEELSSSLQPGS---AACHTLAI 400
Fly 401 TMQFFFLAAFFWLNTMCFNIW------------------------------WTFRDF---RPSSL 432
Fly 433 ERNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETT--LLRPGFGQLYCWFDNRNLSIFAYFYG 495
Fly 496 PIGLLL----------------CANIALFVSTTHQLTCGL 519 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mthl1 | NP_001285340.1 | 7tm_4 | 329..579 | CDD:304433 | 45/248 (18%) |
Adgrg5 | XP_008770523.1 | GPS | 184..228 | CDD:396408 | 8/57 (14%) |
7tm_GPCRs | 243..>349 | CDD:421689 | 23/105 (22%) | ||
TM helix 1 | 243..268 | CDD:410628 | 6/24 (25%) | ||
TM helix 2 | 277..299 | CDD:410628 | 6/21 (29%) | ||
TM helix 3 | 311..338 | CDD:410628 | 7/26 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4193 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |