DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRF1

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_722582.2 Gene:ADGRF1 / 266977 HGNCID:18990 Length:910 Species:Homo sapiens


Alignment Length:604 Identity:128/604 - (21%)
Similarity:207/604 - (34%) Gaps:192/604 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LNDSQPIN---ALEDPDYAANPLVQQ-------EPPKA-SLRLSKCCGKW-----------GSYN 206
            ||.:...|   .|.:..||::.|::.       .||.| .|..|:....|           ..|:
Human   382 LNSASVTNWTVLLREEKYASSRLLETLENISTLVPPTALPLNFSRKFIDWKGIPVNKSQLKRGYS 446

  Fly   207 TQLQNCDLQPNHQAAVDGLLRLSPQLPEGSYQTSYGLPDC--------------------GQPGG 251
            .|::.|  ..|....:.|.:.:      ||.|....||:.                    .|..|
Human   447 YQIKMC--PQNTSIPIRGRVLI------GSDQFQRSLPETIISMASLTLGNILPVSKNGNAQVNG 503

  Fly   252 YSIAGDWQD----------AKLDRNTAMLQLPH------KNL---SAGQYCLEHTQREGEVKIIA 297
            ..|:...|:          :|::.|   |..||      .:|   .||.:.:..||     .|:.
Human   504 PVISTVIQNYSINEVFLFFSKIESN---LSQPHCVFWDFSHLQWNDAGCHLVNETQ-----DIVT 560

  Fly   298 CQ--HLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHAL 360
            ||  ||.|.:.   :....:..||..     :.|.:...|:.:||        ...:|..:..||
Human   561 CQCTHLTSFSI---LMSPFVPSTIFP-----VVKWITYVGLGISI--------GSLILCLIIEAL 609

  Fly   361 HWR-------------CQICYVTCLLFGKILLAI-EELSSSLQPGSAACHTLAITMQFFFLAAFF 411
            .|:             |.:.....||...:...: ..:.:::.| |..|........||:|:.||
Human   610 FWKQIKKSQTSHTRRICMVNIALSLLIADVWFIVGATVDTTVNP-SGVCTAAVFFTHFFYLSLFF 673

  Fly   412 WL----NTMCFNIWWTFRDFRPSSLERNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLR 472
            |:    ..:.:.|...|....       |..:....:.| .:|.||:|:.:...|.| |..|..|
Human   674 WMLMLGILLAYRIILVFHHMA-------QHLMMAVGFCL-GYGCPLIISVITIAVTQ-PSNTYKR 729

  Fly   473 PGFGQLYCW--FDNRNLSIFAYFYGPIGLLLCAN--IALFVSTTHQLTCGLWK--------RDDV 525
            ..    .||  :.|.:..:.| |..|...::..|  :.|.|.|.      ||:        ||| 
Human   730 KD----VCWLNWSNGSKPLLA-FVVPALAIVAVNFVVVLLVLTK------LWRPTVGERLSRDD- 782

  Fly   526 KSSSEKSALGRVCLKLVVVMGVTW------IADI--LSWLVGGPHGVWFFTDLINALQGVFIFIV 582
            |::..:  :|:..|.|..::|:||      |.|.  |:|     |.::   .|:||.||.||.  
Human   783 KATIIR--VGKSLLILTPLLGLTWGFGIGTIVDSQNLAW-----HVIF---ALLNAFQGFFIL-- 835

  Fly   583 VGCQPQVWTACRRIFC-PRLRHDITNTTNGV--------QHSSSSQGLPSMAGGTEITQN----- 633
                      |..|.. .:||..:.|..:.:        |:||.....|..:......||     
Human   836 ----------CFGILLDSKLRQLLFNKLSALSSWKQTEKQNSSDLSAKPKFSKPFNPLQNKGHYA 890

  Fly   634 -TTTTTTTTNTTATHMPSN 651
             :.|..::.|...|...||
Human   891 FSHTGDSSDNIMLTQFVSN 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 65/287 (23%)
ADGRF1NP_722582.2 SEA 154..>215 CDD:279699
GPS 532..572 CDD:280071 13/47 (28%)
7tm_4 582..834 CDD:304433 65/296 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.