DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Adgrg2

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_852031.1 Gene:Adgrg2 / 266735 RGDID:628618 Length:1013 Species:Rattus norvegicus


Alignment Length:716 Identity:151/716 - (21%)
Similarity:260/716 - (36%) Gaps:177/716 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLQTLVSMSLA-IEEMSPPP--AAPPRP------SPPP--TV--------------KLNKCCH-- 64
            |.||.:|.:|: ::...|.|  |||..|      |.||  ||              ::.|...  
  Rat   323 LPQTDLSHTLSPVQSSIPSPTTAAPSVPEKVVAISTPPGETVVNTSSVPDLEAQVSQMEKALSLG 387

  Fly    65 ------SGEYLNDGTCIAGSEALWLPMVYLVQ-QQRFFEPHGASPRFLKFLPNTRPTCRKDQTTE 122
                  :||.:|     ..|:.|..|:..|.. .||..:...|....|.|...|...........
  Rat   388 SLEPNLAGEMVN-----RVSKLLHSPLALLAPLAQRLLKVVDAIGLQLNFSSTTISLTSPSLALA 447

  Fly   123 IFRSRGANVMLFPNGTLYVRERALMVQPSDYCVDWE-------VAVVCLNDS----QPINALE-- 174
            :.|...:|.    |.|.:..:     .|::..|..|       :..:.|..|    .|.:.:|  
  Rat   448 VIRVNASNF----NTTTFAAQ-----DPANLQVSLEAQAPKNSIGAITLPSSLMSNLPASEVELA 503

  Fly   175 ---DPDYAANPLVQQEPPKASLRLSKCCGKWGSY--NTQLQNCDLQPNHQAAVDGLLRLSPQLPE 234
               ..::...|.:.|:|...:|.|.       ||  ::.:.|..::...:.....|..::|...:
  Rat   504 SRVQFNFFETPALFQDPSLENLSLI-------SYVISSSVTNMTIKNLTRNVTVALKHINPSQDD 561

  Fly   235 GSYQTSYGLPDCGQPGGYSIAGDWQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIACQ 299
            .:.:..:.  |..:.||   .|.|.                  |.|  |....:|..|. |..|.
  Rat   562 LTVKCVFW--DLNRNGG---RGGWS------------------SDG--CSVKEKRMNET-ICTCS 600

  Fly   300 HLFSSAAGAGIHDGSIGGTIEQANGQNL---QKAVLTG----GILVSIVFLSATLVAGFLLPAVH 357
            ||.|.            |.:...:..:|   |...||.    |..:|.:|||.|||.......:.
  Rat   601 HLTSF------------GILLDLSRTSLPPSQMMALTFITYIGCGLSSIFLSVTLVTYIAFEKIR 653

  Fly   358 HALHWR--CQICYVTCLLFGKILLAIEELSS--SLQPGSAACHTLAITMQFFFLAAFFWLNTMCF 418
            .....:  .|:| ...||...:.|    |.|  :|......|.::|:.:.:|.|.:|.|:....|
  Rat   654 RDYPSKILIQLC-AALLLLNLVFL----LDSWIALYNARGFCISVAVFLHYFLLVSFTWMGLEAF 713

  Fly   419 NIWW----TFRDFRPSSLERNQEALRRYL--YSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQ 477
            :::.    .|..:           :|:|:  :.:..||.|.::..:...:.  |:..    |.|.
  Rat   714 HMYLALVKVFNTY-----------IRKYILKFCIVGWGIPAVVVSIVLTIS--PDNY----GIGS 761

  Fly   478 L----------YCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKS 532
            .          :||. |.::..:....|...::...|:::|:....|| |.:.|:..:.:..:.|
  Rat   762 YGKFPNGTPDDFCWI-NSSVVFYITVVGYFCVIFLLNVSMFIVVLVQL-CRIKKKKQLGAQRKTS 824

  Fly   533 ALG-RVCLKLVVVMGVTWIADILSWLVGGPHGVWF--FTDLINALQGVFIFI-VVGCQPQVWTAC 593
            ... |....|..::|:||.....:|   ||..:.|  ...:.|.|||.|||| ....:..|....
  Rat   825 IQDLRSIAGLTFLLGITWGFAFFAW---GPVNLTFMYLFAIFNTLQGFFIFIFYCAAKENVRKQW 886

  Fly   594 RR-IFCPRLR----HDITNT-TNGVQHSSSSQGLPSMAGGTEITQNTTTTTT--TTNTTATHMPS 650
            || :.|.:||    .|.:.| |||::..:.:||:.|.:...:.:.|:|.:||  ..:..:.|...
  Rat   887 RRYLCCGKLRLAENSDWSKTATNGLKKQTVNQGVSSSSNSLQSSCNSTNSTTLLVNSDCSVHASG 951

  Fly   651 N 651
            |
  Rat   952 N 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 58/276 (21%)
Adgrg2NP_852031.1 GPS 566..608 CDD:280071 16/79 (20%)
7tm_4 621..871 CDD:304433 58/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.