DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Adgre5

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_036055.2 Gene:Adgre5 / 26364 MGIID:1347095 Length:818 Species:Mus musculus


Alignment Length:690 Identity:144/690 - (20%)
Similarity:232/690 - (33%) Gaps:232/690 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QTLVSMSLAIEEMSPPPAAPPRPSPPPTVKLNKCCHSGEYLNDGTCIAGSEALWLPMVYLVQQQR 93
            |||:..|:.::.:.       |...|.||         .|.......|..:.|..||....||..
Mouse   277 QTLLRFSVEVQNLL-------RDFNPATV---------NYTIQKLIEAVDKLLEDPMETETQQVA 325

  Fly    94 FFEPHGASPRFLKFLPNTRPTCRKDQTTEIFRSRGANVMLFPNGTLYVRERALMVQPSD------ 152
                       .:.|.|...:.|   |...|..:|......|:.|    |.:|||:..|      
Mouse   326 -----------AQLLSNLEQSLR---TLAQFLPKGPFTYTSPSNT----ELSLMVKEQDNKDVTT 372

  Fly   153 -------YCVDWEV---AVVCLNDSQPINALEDP---------------------DYAANPLVQQ 186
                   ..:||.|   |.:..|.|.....|..|                     |:..:|:   
Mouse   373 VHHGQTWMELDWAVTAGAKISENGSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPI--- 434

  Fly   187 EPPKASLRLSKCCGKWGSYNTQLQNC--------------DLQPNHQAAVDGLLRLSPQLPEGSY 237
              |..||:|..........||..:..              .::|.|:..                
Mouse   435 --PSVSLKLLSNINSVFLTNTNTEKLASNVTFKFDFTSVESIEPRHELI---------------- 481

  Fly   238 QTSYGLPDCGQPGGYSIAGDWQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIACQHLF 302
                    |.....::..|.|.......|           ..| :|  |           |.||.
Mouse   482 --------CAFWKAHNGNGYWDTDGCSMN-----------GTG-FC--H-----------CNHLT 513

  Fly   303 SSAAGAGIHDGSIGGTIEQANGQNLQKAVLTG-GILVSIVFLSATLVAGFLLPAVHHA-----LH 361
            |.|.           .:.|.:.|:.:..::|. |:|:|::.|...::...|:..:..:     ||
Mouse   514 SFAI-----------LMAQYHVQDPRLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLH 567

  Fly   362 WRCQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWW-TFR 425
                :|  .||..|.|:..:...:...:.| ..|..:|:.:.|.|||||.|:......::: ..|
Mouse   568 ----LC--ICLFLGSIIFLVGVENEGGEVG-LRCRLVAVMLHFCFLAAFCWMALEGVELYFLVVR 625

  Fly   426 DFRPSSLERNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQ-LYCWFDNRNLSI 489
            .|:...|...|..|..|       |.||||..::..|.::       .|:|. .|||.|.|....
Mouse   626 VFQGQGLSTWQRCLIGY-------GVPLLIVAISMAVVKM-------DGYGHATYCWLDFRKQGF 676

  Fly   490 FAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRV----CLKLVVVMGVTWI 550
            ...|.||:..::..|.|:||.|..:||   .|..::..:.:|....||    .:..::|:|.||.
Mouse   677 LWSFSGPVAFIIFCNAAIFVITVWKLT---KKFSEINPNMKKLRKARVLTITSIAQLLVLGCTWG 738

  Fly   551 ADILSWLVGGPHGVW---FFTDLINALQGVFIFIVVGC------QPQVWT-ACRRIFCPRLRHDI 605
            ..:..:   .||..|   .|| |:|.|||:|::::: |      :.:.|. ||            
Mouse   739 FGLFLF---NPHSTWLSYIFT-LLNCLQGLFLYVML-CLLNKKVREEYWKWAC------------ 786

  Fly   606 TNTTNGVQHSSSSQGLPSMAGGTEITQ-NTTTTTTTTNTT 644
                              |..|::.|: |::||.|.|:.|
Mouse   787 ------------------MVTGSKYTEFNSSTTGTGTSQT 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 70/264 (27%)
Adgre5NP_036055.2 EGF_CA 69..118 CDD:284955
EGF_CA 165..212 CDD:284955
EGF_CA 214..248 CDD:284955
GPS 480..518 CDD:280071 12/97 (12%)
7tm_2 526..766 CDD:278432 70/267 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 799..818 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8041
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.