DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRL1

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_016881964.1 Gene:ADGRL1 / 22859 HGNCID:20973 Length:1506 Species:Homo sapiens


Alignment Length:593 Identity:138/593 - (23%)
Similarity:223/593 - (37%) Gaps:150/593 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VRERALMVQPSDYCVDWEVAVVCLNDSQPINALEDPDYAANPLVQQEPPKASLRLSKCCGKWGSY 205
            |||.|..:...:..|   :.|..||....:..|..|.       ::.|.|.|::||....|..|.
Human   674 VREPARFLAAKENVV---LEVTVLNTEGQVQELVFPQ-------EEYPRKNSIQLSAKTIKQNSR 728

  Fly   206 NTQLQNCDLQPNHQAAVDGLLRLSPQLPEGSYQTSYGLPDCGQPGGYSIAGDWQ--DAKLDRNTA 268
            |..::...:..|:..     |.||   .|.:.....|....|.|||.|:..:.|  .|.:::.::
Human   729 NGVVKVVFILYNNLG-----LFLS---TENATVKLAGEAGPGGPGGASLVVNSQVIAASINKESS 785

  Fly   269 MLQLP----------------HKNLSAGQY----CLEHTQREGEVKII---------ACQHLFSS 304
            .:.|.                :.|.|...|    .|.:...:| .:::         ||.||.:.
Human   786 RVFLMDPVIFTVAHLEDKNHFNANCSFWNYSERSMLGYWSTQG-CRLVESNKTHTTCACSHLTNF 849

  Fly   305 A---AGAGIHDGSIGGTIEQANGQNLQKAVLTG-GILVSIVFLSATLVAGFL----LPAVHHALH 361
            |   |...|:.|.|         ..|..:|:|. ||::|:|.| |..::.|.    |....:.:|
Human   850 AVLMAHREIYQGRI---------NELLLSVITWVGIVISLVCL-AICISTFCFLRGLQTDRNTIH 904

  Fly   362 WR-CQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFR 425
            .. |...::..|||   |:.|::....:     ||...|..:.:||||||.||.....:::....
Human   905 KNLCINLFLAELLF---LVGIDKTQYEI-----ACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLV 961

  Fly   426 DFRPSSLERNQEALRRYLYSLYAWGG---PLLITFVAACVDQLPETTLLRPGFGQLYCWFDNRNL 487
            :...|...|.     :|.|    .||   |.|:..:||.:|.....|       :..||....|.
Human   962 EVFESEYSRT-----KYYY----LGGYCFPALVVGIAAAIDYRSYGT-------EKACWLRVDNY 1010

  Fly   488 SIFAYFYGPIGLLLCANIALFVSTTHQL--TCGLWKRDDVKSSSEKS-ALGRVCLKLVVVMGVTW 549
            .|:: |.||:..::..|:...:.|.|::  :..:.|.|..:..:.|| |||.:.  |:.::|:||
Human  1011 FIWS-FIGPVSFVIVVNLVFLMVTLHKMIRSSSVLKPDSSRLDNIKSWALGAIA--LLFLLGLTW 1072

  Fly   550 IADILSWLVGGPHGVWFFTDLINALQGVFIFIV-VGCQPQV---WTACRRIFCPRLRHD---ITN 607
            ...:|..........:.|| ..||.||||||:. ...|.:|   ::.|       |||.   |.:
Human  1073 AFGLLFINKESVVMAYLFT-TFNAFQGVFIFVFHCALQKKVHKEYSKC-------LRHSYCCIRS 1129

  Fly   608 TTNGVQHSSSSQGLPS----------------------------MAGGTEITQNTTTTTTTTNTT 644
            ...|...|..:..:.|                            |||..     .:|.|....|.
Human  1130 PPGGTHGSLKTSAMRSNTRYYTGTQSRIRRMWNDTVRKQTESSFMAGDI-----NSTPTLNRGTM 1189

  Fly   645 ATHMPSNP 652
            ..|:.:||
Human  1190 GNHLLTNP 1197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 69/261 (26%)
ADGRL1XP_016881964.1 Gal_Lectin 48..128 CDD:396628
OLF 143..399 CDD:413369
PHA03247 <399..503 CDD:223021
HormR 484..547 CDD:214468
GAIN 557..782 CDD:406802 31/125 (25%)
GPS 806..858 CDD:197639 11/52 (21%)
7tmB2_Latrophilin-1 865..1122 CDD:320673 77/292 (26%)
TM helix 1 868..892 CDD:320673 9/24 (38%)
TM helix 2 901..922 CDD:320673 6/23 (26%)
TM helix 3 932..954 CDD:320673 9/21 (43%)
TM helix 4 973..989 CDD:320673 6/19 (32%)
TM helix 5 1008..1031 CDD:320673 6/23 (26%)
TM helix 6 1058..1080 CDD:320673 8/23 (35%)
TM helix 7 1084..1109 CDD:320673 10/25 (40%)
Latrophilin 1121..1506 CDD:396778 15/82 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.