DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRF2

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001355044.1 Gene:ADGRF2 / 222611 HGNCID:18991 Length:708 Species:Homo sapiens


Alignment Length:434 Identity:82/434 - (18%)
Similarity:139/434 - (32%) Gaps:164/434 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LVQQEPPKASLRLSKCCGKWGSYNTQ--LQNCD-LQPNHQAAV----------DGLLRLSPQLPE 234
            |:.::..|:..|.::|.| |.|...:  .|.|. :|.|.|.||          ...:.:||.:.|
Human   379 LIFEKISKSEERRTQCVG-WHSVENRWDQQACKMIQENSQQAVCKCRPSKLFTSFSILMSPHILE 442

  Fly   235 G---SYQTSYGLPDCGQPGGYSIAGDWQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKII 296
            .   :|.|..||       |.||.                                      .:|
Human   443 SLILTYITYVGL-------GISIC--------------------------------------SLI 462

  Fly   297 ACQHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTGGILVSIVFLSATL--------VAGFLL 353
            .|.                  :||......:.|..:|....|.||.::|||        ||.||.
Human   463 LCL------------------SIEVLVWSQVTKTEITYLRHVCIVNIAATLLMADVWFIVASFLS 509

  Fly   354 -PAVHHALHWRCQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNT-- 415
             |..||                                  ..|......:.||:|:.|||:..  
Human   510 GPITHH----------------------------------KGCVAATFFVHFFYLSVFFWMLAKA 540

  Fly   416 --MCFNIWWTFRDFRPSSLERNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQL 478
              :.:.|...|.....|.|..:       |:|: .:|.||.|..:.....:        ||.|.|
Human   541 LLILYGIMIVFHTLPKSVLVAS-------LFSV-GYGCPLAIAAITVAATE--------PGKGYL 589

  Fly   479 ---YCWFD-NRNLSIFAYFYGPIGLLL--CANIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRV 537
               .||.: :...::.|:....:.:::  ...:.|.:..|.:...|.....:|:      |:.|:
Human   590 RPEICWLNWDMTKALLAFVIPALAIVVVNLITVTLVIVKTQRAAIGNSMFQEVR------AIVRI 648

  Fly   538 CLKLVV---VMGVTW---IADILSWLVGGPHGVWFFTDLINALQ 575
            ...:.:   ::|:||   :|.::.......|.::   .|:||.|
Human   649 SKNIAILTPLLGLTWGFGVATVIDDRSLAFHIIF---SLLNAFQ 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 54/272 (20%)
ADGRF2NP_001355044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.