DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRG5

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001291305.1 Gene:ADGRG5 / 221188 HGNCID:19010 Length:528 Species:Homo sapiens


Alignment Length:537 Identity:107/537 - (19%)
Similarity:187/537 - (34%) Gaps:159/537 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SRGANVMLFPNGTLYVRERALMVQPSDYCVDWEVAVVCLNDSQPINALEDPDYAANPLVQQEPPK 190
            :||.:.|.||   ..:...|...:|.      |:.::|:             |.:|....::...
Human   105 ARGQHAMQFP---AELTRDACKTRPR------ELRLICI-------------YFSNTHFFKDENN 147

  Fly   191 ASLRLSKCCG---KWGSYNTQLQNCDLQPNHQAAVDGLLRLSPQLPEGSYQTSYGLPDCGQP-GG 251
            :||..:...|   ..|..|......::...|..:::|.........||:.:         || ||
Human   148 SSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARK---------QPWGG 203

  Fly   252 YSIAGDWQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIA-CQHLFSSAAGAGIHDGSI 315
            :|..|                          |  .|::....:::. |.||...|          
Human   204 WSPEG--------------------------C--RTEQPSHSQVLCRCNHLTYFA---------- 230

  Fly   316 GGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHALHWRCQI---------CYVTC 371
              .:.|.:...:...:|.....:|:|..|.::||..:...:|  .|:|.|.         .:.:.
Human   231 --VLMQLSPALVPAELLAPLTYISLVGCSISIVASLITVLLH--FHFRKQSDSLTRIHMNLHASV 291

  Fly   372 LLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERNQ 436
            ||.....|.....:.|..||| ||..||..:.:..|:...|:....||::..        |.|..
Human   292 LLLNIAFLLSPAFAMSPVPGS-ACTALAAALHYALLSCLTWMAIEGFNLYLL--------LGRVY 347

  Fly   437 EA-LRRYLYSL--YAWGGPLLITFVAACVDQLPETTLLRP-------------GFGQL-YCWFDN 484
            .. :|||::.|  ..||.|.|:..::..|    ::::..|             ||..: .||..:
Human   348 NIYIRRYVFKLGVLGWGAPALLVLLSLSV----KSSVYGPCTIPVFDSWENGTGFQNMSICWVRS 408

  Fly   485 RNL-SIFAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRVC------LKLV 542
            ..: |:....||  ||....|:.:       |...||....::..::..:: |.|      |.|.
Human   409 PVVHSVLVMGYG--GLTSLFNLVV-------LAWALWTLRRLRERADAPSV-RACHDTVTVLGLT 463

  Fly   543 VVMGVTWIADILSWLVGGPHGVW-----FFTDLINALQGVFIFIVVGCQPQVWTACRRIFCPRLR 602
            |::|.||.....|:      ||:     |...::|:|.|.|:|:        |      ||.:..
Human   464 VLLGTTWALAFFSF------GVFLLPQLFLFTILNSLYGFFLFL--------W------FCSQRC 508

  Fly   603 HDITNTTNGVQHSSSSQ 619
            .........::..||||
Human   509 RSEAEAKAQIEAFSSSQ 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 65/287 (23%)
ADGRG5NP_001291305.1 GPS 187..232 CDD:307782 14/93 (15%)
7tmB2_GPR114 245..518 CDD:320559 70/317 (22%)
TM helix 1 247..272 CDD:320559 6/26 (23%)
TM helix 2 281..303 CDD:320559 3/21 (14%)
TM helix 3 315..342 CDD:320559 6/26 (23%)
TM helix 4 355..375 CDD:320559 5/19 (26%)
TM helix 5 409..438 CDD:320559 9/37 (24%)
TM helix 6 451..478 CDD:320559 9/32 (28%)
TM helix 7 482..507 CDD:320559 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.