DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRE1

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_011526096.1 Gene:ADGRE1 / 2015 HGNCID:3336 Length:978 Species:Homo sapiens


Alignment Length:265 Identity:67/265 - (25%)
Similarity:115/265 - (43%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 GILVSIVFLSATLVAGFLL--PAVHHALHWRCQICYVTCLLFGK--ILLAIEELSSSLQPGSAAC 395
            ||::|:|.| ...:|.|||  ...:|..:....:|  .|||..|  .|..|.:..:.:     .|
Human   701 GIIISLVCL-VLAIATFLLCRSIRNHNTYLHLHLC--VCLLLAKTLFLAGIHKTDNKM-----GC 757

  Fly   396 HTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSL--ERNQEALRRYLYSLYAWGGPLLITFV 458
            ..:|..:.:.|||.|||:......::...|:.:..:.  .||.:.|.   ...:.:|.|:|:..:
Human   758 AIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVVNYFSSRNIKMLH---ICAFGYGLPMLVVVI 819

  Fly   459 AACVDQLPETTLLRPGFG-QLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLW-- 520
            :|.|.  |:      |:| ...||.:.....|:: |.||:..::..|..|       ||..||  
Human   820 SASVQ--PQ------GYGMHNRCWLNTETGFIWS-FLGPVCTVIVINSLL-------LTWTLWIL 868

  Fly   521 ------KRDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGV--WFFTDLINALQGV 577
                  ...:|.:..:...|.......:.::|.:|:..|..  :|...||  :.|| :||:|||.
Human   869 RQRLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQ--IGPVAGVMAYLFT-IINSLQGA 930

  Fly   578 FIFIV 582
            |||::
Human   931 FIFLI 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 64/260 (25%)
ADGRE1XP_011526096.1 EGF_CA 33..62 CDD:238011
EGF_CA 80..114 CDD:214542
EGF_CA 132..171 CDD:214542
EGF_CA 172..206 CDD:214542
EGF_CA 224..260 CDD:214542
EGF_CA 264..297 CDD:214542
EGF_CA 313..>342 CDD:214542
EGF_CA 360..400 CDD:284955
GPS 638..687 CDD:197639
7tm_2 691..932 CDD:278432 64/260 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.