DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Adgrl4

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_573485.2 Gene:Adgrl4 / 170757 MGIID:2655562 Length:739 Species:Mus musculus


Alignment Length:367 Identity:80/367 - (21%)
Similarity:132/367 - (35%) Gaps:115/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 YSI----AGDWQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIACQH------LFSSAA 306
            ||:    .|.|       :|...:|.|.|.:       ||.       ..|.|      |.||.:
Mouse   423 YSVDAMNNGSW-------STEGCELTHSNDT-------HTS-------CRCSHLTHFAILMSSTS 466

  Fly   307 GAGIHDGSIGGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAGFL---LPAVHHALHWRCQICY 368
            ..||.|.:|...|.|.            ||::|::.|:..:...:.   :.:....:|  ..:| 
Mouse   467 SIGIKDYNILTRITQL------------GIIISLICLAICIFTFWFFSEIQSTRTTIH--KNLC- 516

  Fly   369 VTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLE 433
              |.||...|:.:  :..::......|..:|..:.:||||||.|   ||.               
Mouse   517 --CSLFLAELVFL--IGININTNKLVCSIIAGLLHYFFLAAFAW---MCI--------------- 559

  Fly   434 RNQEALRRYL---------------YSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLY---- 479
               |.:..||               :.::.:..|.::...:|             ..|..|    
Mouse   560 ---EGIHLYLIVVGVIYNKGFLHKNFYIFGYLSPAVVVGFSA-------------SLGYRYYGTT 608

  Fly   480 --CWFDNRNLSIFAYFYGPIGLLLCANIALF---VSTTHQLTCGLWKRDDVKSSSEKSALGRVCL 539
              ||....|..|:: |.||..|::..|:..|   :....:.|.||  :.:|.......:..|..|
Mouse   609 KVCWLSTENNFIWS-FIGPACLIILVNLLAFGVIIYKVFRHTAGL--KPEVSCYENIRSCARGAL 670

  Fly   540 KLVVVMGVTWIADILSWLVGGPHGVWFFTDLINALQGVFIFI 581
            .|:.::|.|||..:|..:.......:.|| :.||.||:|||:
Mouse   671 ALLFLLGTTWIFGVLHVVHASVVTAYLFT-VSNAFQGMFIFL 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 56/276 (20%)
Adgrl4NP_573485.2 EGF_CA 58..91 CDD:214542
EGF_CA 108..141 CDD:214542
GAIN 190..370 CDD:293098
GPS 417..461 CDD:280071 12/58 (21%)
7tm_4 473..709 CDD:304433 59/292 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.