DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRG4

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_722576.3 Gene:ADGRG4 / 139378 HGNCID:18992 Length:3080 Species:Homo sapiens


Alignment Length:410 Identity:94/410 - (22%)
Similarity:159/410 - (38%) Gaps:91/410 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 IIACQHLFSSAAGAGIHDGSI----GGTIEQANGQNLQKAVLTG-GILVSIVFLSATLVAGFLLP 354
            |..|.||        .|.|.:    ..|::..|.|.|.....|| ||  |.:||...:|......
Human  2715 ICQCDHL--------THFGVLMDLSRSTVDSVNEQILALITYTGCGI--SSIFLGVAVVTYIAFH 2769

  Fly   355 AVHHALHWRCQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFN 419
            .:......:..|...|.||...::..|....||.|. ...|.|.|:.:.:|.|.:|.|:.....:
Human  2770 KLRKDYPAKILINLCTALLMLNLVFLINSWLSSFQK-VGVCITAAVALHYFLLVSFTWMGLEAVH 2833

  Fly   420 IWW----TFRDFRPSSLERNQEALRRYLYSLYAWGGPLLITFVAACVDQ-----LPETTLLRPGF 475
            ::.    .|..:.|:.:.:         :.|..||.|.::..:...|.:     |..||   |  
Human  2834 MYLALVKVFNIYIPNYILK---------FCLVGWGIPAIMVAITVSVKKDLYGTLSPTT---P-- 2884

  Fly   476 GQLYCWFDNRN---LSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRV 537
               :||..:.:   :|:.|||.    |:...|:::|.:...||       :.|||..:|:....:
Human  2885 ---FCWIKDDSIFYISVVAYFC----LIFLMNLSMFCTVLVQL-------NSVKSQIQKTRRKMI 2935

  Fly   538 ------CLKLVVVMGVTWIADILSWLVGGPHGVWF--FTDLINALQGVFIFIV-------VGCQP 587
                  .:.|..::|:||.....:|   ||...:|  ...:.|.|||.|||:.       |..|.
Human  2936 LHDLKGTMSLTFLLGLTWGFAFFAW---GPMRNFFLYLFAIFNTLQGFFIFVFHCVMKESVREQW 2997

  Fly   588 QVWTACRRIFCPRLRHDITNTTNG-----VQHSSSSQGLPSMAGGTEITQN-TTTTTTTTNTTAT 646
            |:     .:.|..||.|  |:::|     ::.....:||..:.....:|.: .:|.|::|..:..
Human  2998 QI-----HLCCGWLRLD--NSSDGSSRCQIKVGYKQEGLKKIFEHKLLTPSLKSTATSSTFKSLG 3055

  Fly   647 HMPSNPAEDEVP----EKAP 662
            .....|:|...|    :|.|
Human  3056 SAQGTPSEISFPNDDFDKDP 3075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 61/270 (23%)
ADGRG4NP_722576.3 LamG 28..210 CDD:304605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 946..965
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1274..1348
CytochromB561_N <1668..>1909 CDD:286826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2109..2141
GPS 2684..2727 CDD:280071 6/19 (32%)
7tm_2 2743..2982 CDD:278432 62/272 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3051..3080 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.