DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Adgre1

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001342651.1 Gene:Adgre1 / 13733 MGIID:106912 Length:931 Species:Mus musculus


Alignment Length:382 Identity:87/382 - (22%)
Similarity:154/382 - (40%) Gaps:74/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 YCLEHTQREGEVKIIACQHLFS-------SAAGAGIHDGSIGGTIEQANGQ-NLQKAVLTG---- 334
            |.|:|.|.:.:.:...|....:       :.:|..|.:.|...|:...|.. ||...:.:|    
Mouse   579 YTLQHIQPKQKSERPICVSWNTDVEDGRWTPSGCEIVEASETHTVCSCNRMANLAIIMASGELTM 643

  Fly   335 ----------GILVSIVFLSATLVAGFLLPAV-HHALHWRCQICYVTCLLFGKILL--AIEELSS 386
                      |.::|:|.|:..:....|..|| :|..:....:|  .||...|||.  .|::..:
Mouse   644 EFSLYIISHVGTVISLVCLALAIATFLLCRAVQNHNTYMHLHLC--VCLFLAKILFLTGIDKTDN 706

  Fly   387 SLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSL--ERNQEALRRYLYSLYAW 449
                 ..||..:|..:.:.|||.|||:......::...|:.:..:.  .||.:.|.   ...:.:
Mouse   707 -----QTACAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLH---LCAFGY 763

  Fly   450 GGPLLITFVAACVDQLPETTLLRPGFG-QLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVST-- 511
            |.|:|:..::|.|.  |.      |:| ...||.:.....|:: |.||:.:::..|..|...|  
Mouse   764 GLPVLVVIISASVQ--PR------GYGMHNRCWLNTETGFIWS-FLGPVCMIITINSVLLAWTLW 819

  Fly   512 -THQLTCGLWKRDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHG---VWFFTDLIN 572
             ..|..|.:  ..:|....:...|....:..:.::|.:|:..|...   ||..   .:.|| :||
Mouse   820 VLRQKLCSV--SSEVSKLKDTRLLTFKAIAQIFILGCSWVLGIFQI---GPLASIMAYLFT-IIN 878

  Fly   573 ALQGVFIFIVVGC--QPQVWTACRRIFCPRLRHDITNTTNGVQHSSSS----QGLPS 623
            :|||.|||: :.|  ..||....:::        :|..|:...||.:|    ..:||
Mouse   879 SLQGAFIFL-IHCLLNRQVRDEYKKL--------LTRKTDLSSHSQTSGILLSSMPS 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 62/275 (23%)
Adgre1NP_001342651.1 EGF_CA 33..63 CDD:238011
EGF_CA 81..115 CDD:214542
EGF_CA 133..172 CDD:214542
EGF_CA 173..>203 CDD:214542
EGF_CA 222..258 CDD:238011
EGF_CA 272..>301 CDD:214542
EGF_CA 319..352 CDD:214542
Cell attachment site. /evidence=ECO:0000255 506..508
GPS 591..640 CDD:197639 8/48 (17%)
7tmB2_EMR 644..906 CDD:320555 67/295 (23%)
TM helix 1 646..671 CDD:320555 4/24 (17%)
TM helix 2 680..702 CDD:320555 6/23 (26%)
TM helix 3 711..738 CDD:320555 7/26 (27%)
TM helix 4 755..775 CDD:320555 4/22 (18%)
TM helix 5 792..815 CDD:320555 6/23 (26%)
TM helix 6 839..864 CDD:320555 4/27 (15%)
TM helix 7 868..893 CDD:320555 11/26 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.