powered by:
Protein Alignment mthl1 and LOC110439897
DIOPT Version :9
Sequence 1: | NP_001285340.1 |
Gene: | mthl1 / 32637 |
FlyBaseID: | FBgn0030766 |
Length: | 676 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021333226.1 |
Gene: | LOC110439897 / 110439897 |
-ID: | - |
Length: | 111 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 20/70 - (28%) |
Similarity: | 32/70 - (45%) |
Gaps: | 9/70 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 454 LITFVAACVD--QLPETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQLT 516
::..|..||. .:|| |:|..:||.......|:: |.||:.::|..|:.||:.....|.
Zfish 37 VLAMVVVCVSIGLVPE------GYGSEHCWIKYDKGFIWS-FLGPVCVILALNLILFIRIVIYLN 94
Fly 517 CGLWK 521
..|.|
Zfish 95 SALSK 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1153592at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.