DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and LOC103911493

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_021326603.1 Gene:LOC103911493 / 103911493 -ID:- Length:301 Species:Danio rerio


Alignment Length:263 Identity:55/263 - (20%)
Similarity:104/263 - (39%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 GILVSIVFLSATLVAGFLLPAVHHALHWRCQICYVTCLLFGKI-LLAIEELSSSLQPGSAACHTL 398
            |..:|:.||:..|...|||.........:..|..:..|.|..: .|:.|.:::|  ....||..:
Zfish    25 GCGISVFFLAIALFMHFLLRKAKSNQATKILINILVALFFLNVSFLSNESVANS--GDKNACVFI 87

  Fly   399 AITMQFFFLAAFFWLNTMCFNIW-WTFRDFRPSSLERNQEALRRYL--YSLYAWGGPLLITFVAA 460
            |:.|.:..|..|.|......::: |         |.|....:..|:  .::..||..:.|.....
Zfish    88 ALLMHYSMLTTFTWFFIQALHMYLW---------LIRQNVTITNYMRKITVLGWGVSMPIVVAVL 143

  Fly   461 CVDQLPETTLLRPGFGQL--YCWFDNRNLSIFAYFYGPIG----LLLCANIALFVSTTHQLTCGL 519
            ........||.... |::  .||..:    :|..:...||    :.:...|...:|.|:     :
Zfish   144 STGGYKAVTLSSTS-GKIARMCWITD----LFIQYIVNIGFYSLVFIFTTIIFIISVTN-----I 198

  Fly   520 WKRDDVKSSSEKSALGR----VCLKLVVVMGVTWIADILSWLVGGPHGV--WFFTDLINALQGVF 578
            ::..|::::..|....|    :.|.|..:.|:||.....|:   ||..:  ::...::|:.||.|
Zfish   199 FQSRDIRATEGKRLTFRKQLMMVLSLFFLFGLTWAVAFFSY---GPMLIPSYYIFSVLNSFQGFF 260

  Fly   579 IFI 581
            :|:
Zfish   261 LFL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 53/259 (20%)
LOC103911493XP_021326603.1 7tm_GPCRs 18..265 CDD:333717 55/263 (21%)
TM helix 1 18..42 CDD:320095 5/16 (31%)
TM helix 2 52..73 CDD:320095 4/20 (20%)
TM helix 3 85..107 CDD:320095 5/21 (24%)
TM helix 4 126..142 CDD:320095 3/15 (20%)
TM helix 5 169..192 CDD:320095 4/22 (18%)
TM helix 6 215..240 CDD:320095 7/27 (26%)
TM helix 7 244..265 CDD:320095 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.