DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and adgrf11

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_005160858.1 Gene:adgrf11 / 100537132 ZFINID:ZDB-GENE-121214-165 Length:691 Species:Danio rerio


Alignment Length:273 Identity:59/273 - (21%)
Similarity:108/273 - (39%) Gaps:62/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 GILVSIVFLSATLVAGFLLPAVHHALHW----RCQICYV--TCLLFGKILLAIEEL-----SSSL 388
            |:.:|::.|..:|:.|        |:.|    :....|:  .||:...:.|.:.::     :|.:
Zfish   381 GLGISVLSLVISLIIG--------AIVWTTVTKSNSAYLRHVCLVNTNVSLLVADVCFIIGASIV 437

  Fly   389 QPGSAA----CHTLAITMQFFFLAAFFW----------LNTMCFNIWWTFRDFRPSSLER-NQEA 438
            |||..|    |..:|.:|..||||.|||          :.||.:           |.:.| ...|
Zfish   438 QPGQLAPVGPCTAVAFSMHLFFLAFFFWMLISAMLLLYMTTMVY-----------SQMSRAKMMA 491

  Fly   439 LRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCA 503
            :..:|    .:|.||||..:...:.......:|...    .||.:.........|..........
Zfish   492 IAFFL----GYGAPLLIVVITYGLTAREGKYILEAD----VCWLNFDETKALQIFVSLASSFTAV 548

  Fly   504 NIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRVCLKLVVVMGVTW---IADILSWLVGGPHGVW 565
            |:.:.:...:::.  :.::...|.::....:.||.|.:..:.||||   |..:||    ..:|:.
Zfish   549 NVLIIIVVLYKML--IVRKQQNKETNILPTVTRVVLIVSPLFGVTWGLGIGTMLS----PDYGIH 607

  Fly   566 FFTDLINALQGVF 578
            ....::|:|||:|
Zfish   608 LVFTILNSLQGIF 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 59/273 (22%)
adgrf11XP_005160858.1 GAIN 143..>227 CDD:293098
GPS 318..363 CDD:280071
7tm_4 374..620 CDD:304433 58/271 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.