powered by:
Protein Alignment SNRPG and SMX2
DIOPT Version :9
Sequence 1: | NP_001138209.1 |
Gene: | SNRPG / 32636 |
FlyBaseID: | FBgn0261791 |
Length: | 76 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_116636.1 |
Gene: | SMX2 / 850528 |
SGDID: | S000002965 |
Length: | 77 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 41/73 - (56%) |
Similarity: | 56/73 - (76%) |
Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNN--IGM-VVIRGNSIV 68
||:||||||:::|.:||.|.|.|||||:|.|:||||||.:|...::..|| :|: .|||||||:
Yeast 5 PELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSII 69
Fly 69 MVEALDRV 76
.:||||.:
Yeast 70 SLEALDAI 77
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SNRPG | NP_001138209.1 |
Sm_G |
5..74 |
CDD:212466 |
39/69 (57%) |
SMX2 | NP_116636.1 |
Sm_G |
3..75 |
CDD:212466 |
39/69 (57%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
69 |
1.000 |
Domainoid score |
I2307 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1780 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
81 |
1.000 |
Inparanoid score |
I1616 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG53808 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003135 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto99702 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102408 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10553 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1275 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X2104 |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
13 | 12.860 |
|
Return to query results.
Submit another query.