DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and SMX2

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_116636.1 Gene:SMX2 / 850528 SGDID:S000002965 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:41/73 - (56%)
Similarity:56/73 - (76%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNN--IGM-VVIRGNSIV 68
            ||:||||||:::|.:||.|.|.|||||:|.|:||||||.:|...::..||  :|: .|||||||:
Yeast     5 PELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSII 69

  Fly    69 MVEALDRV 76
            .:||||.:
Yeast    70 SLEALDAI 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 39/69 (57%)
SMX2NP_116636.1 Sm_G 3..75 CDD:212466 39/69 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2307
eggNOG 1 0.900 - - E1_KOG1780
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1616
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53808
OrthoFinder 1 1.000 - - FOG0003135
OrthoInspector 1 1.000 - - oto99702
orthoMCL 1 0.900 - - OOG6_102408
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1275
SonicParanoid 1 1.000 - - X2104
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.