DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and LSM8

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001185323.1 Gene:LSM8 / 842881 AraportID:AT1G65700 Length:141 Species:Arabidopsis thaliana


Alignment Length:109 Identity:20/109 - (18%)
Similarity:44/109 - (40%) Gaps:47/109 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MDKRMMLKLNGGRAVTGILRGFDPFMNVVLDD--------------------------------- 44
            :|:.:.:..|.||.:.|:|:|||...|::||:                                 
plant    11 VDQIISVITNDGRNIVGVLKGFDQATNIILDESHERVFSTKCHLFNRILRKLTQIFKIGLVLQFF 75

  Fly    45 ---------TVEECK----DNTKNNI-GMVVIRGNSIVMVEALD 74
                     ::::|.    :..:.:: |:.:|||::|.::..||
plant    76 VCMSGHVDTSLDKCSWIFLEGVQQHVLGLYIIRGDNIGVIGELD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 18/107 (17%)
LSM8NP_001185323.1 LSm8 7..137 CDD:212474 20/109 (18%)

Return to query results.
Submit another query.