DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and LSM1A

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_564072.1 Gene:LSM1A / 838495 AraportID:AT1G19120 Length:128 Species:Arabidopsis thaliana


Alignment Length:87 Identity:28/87 - (32%)
Similarity:46/87 - (52%) Gaps:17/87 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAHPPEV------KKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEE-------CKDN 52
            ||.|.|.::      ..|:||::::.|..||.:.|:||.||.|.|.||::..|.       |   
plant     1 MSWAAPDDIFFSTSLAAYLDKKLLVLLRDGRKLMGLLRSFDQFANAVLEEAYERVIVGDLYC--- 62

  Fly    53 TKNNIGMVVIRGNSIVMVEALD 74
             ...:|:.:|||.::|::..||
plant    63 -DIPLGLYIIRGENVVLIGELD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 23/81 (28%)
LSM1ANP_564072.1 LSm1 9..82 CDD:212475 22/76 (29%)

Return to query results.
Submit another query.