DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SNRPG and AT3G11500

DIOPT Version :9

Sequence 1:	NP_001138209.1	Gene:	SNRPG / 32636	FlyBaseID:	FBgn0261791	Length:	76	Species:	Drosophila melanogaster
Sequence 2:	NP_001319523.1	Gene:	AT3G11500 / 820323	AraportID:	AT3G11500	Length:	79	Species:	Arabidopsis thaliana

Alignment Length:	77	Identity:	48/77 - (62%)
Similarity:	61/77 - (79%)	Gaps:	2/77 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MSKA-HPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRG 64
            ||:: .||::||||||::.:|||..|.|.|.|||||.|||:|:|:|||...|: |.:||||||||
plant     1 MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGDD-KTDIGMVVIRG 64

  Fly    65 NSIVMVEALDRV 76
            ||||.||||:.|
plant    65 NSIVTVEALEPV 76

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SNRPG	NP_001138209.1	Sm_G	5..74	CDD:212466	44/68 (65%)
AT3G11500	NP_001319523.1	Sm_G	6..74	CDD:212466	44/68 (65%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	83	1.000	Domainoid score	I2889
eggNOG	1	0.900	-	-		E1_KOG1780
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	94	1.000	Inparanoid score	I2237
OMA	1	1.010	-	-		QHG53808
OrthoDB	1	1.010	-	-		D1593201at2759
OrthoFinder	1	1.000	-	-		FOG0003135
OrthoInspector	1	1.000	-	-		otm3029
orthoMCL	1	0.900	-	-		OOG6_102408
Panther	1	1.100	-	-	LDO	PTHR10553
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X2104
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	13	12.840