DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and EMB2816

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_178480.1 Gene:EMB2816 / 814913 AraportID:AT2G03870 Length:99 Species:Arabidopsis thaliana


Alignment Length:75 Identity:27/75 - (36%)
Similarity:47/75 - (62%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKD--------NTKNNIGMVVIRG 64
            ::.|::||.:.:||.|||.|||.|:|:|..:|:|||:.||..:|        :....:|::|.||
plant    10 DLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFVRDHDDPLKTTDQTRRLGLIVCRG 74

  Fly    65 NSIVMVEALD 74
            .::::|...|
plant    75 TAVMLVSPTD 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 26/73 (36%)
EMB2816NP_178480.1 LSm7 5..93 CDD:212476 27/75 (36%)

Return to query results.
Submit another query.