DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and SNRPG

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001304094.1 Gene:SNRPG / 6637 HGNCID:11163 Length:96 Species:Homo sapiens


Alignment Length:76 Identity:46/76 - (60%)
Similarity:56/76 - (73%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGN 65
            ||||||||:||:|||::.|||||||.|.|||||||||||:|:|:.||......:||||||....|
Human     1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVDNIPN 65

  Fly    66 SIVMVEALDRV 76
            ..|..:.|.:|
Human    66 KAVSPKFLKKV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 40/68 (59%)
SNRPGNP_001304094.1 Sm_G 5..>60 CDD:212466 36/54 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149570
Domainoid 1 1.000 93 1.000 Domainoid score I7555
eggNOG 1 0.900 - - E1_KOG1780
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37730
Inparanoid 1 1.050 118 1.000 Inparanoid score I4799
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53808
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 1 1.000 - - FOG0003135
OrthoInspector 1 1.000 - - otm41453
orthoMCL 1 0.900 - - OOG6_102408
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1275
SonicParanoid 1 1.000 - - X2104
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.