powered by:
Protein Alignment SNRPG and lsm7
DIOPT Version :9
Sequence 1: | NP_001138209.1 |
Gene: | SNRPG / 32636 |
FlyBaseID: | FBgn0261791 |
Length: | 76 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001041471.1 |
Gene: | lsm7 / 573047 |
ZFINID: | ZDB-GENE-030131-8284 |
Length: | 103 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 28/71 - (39%) |
Similarity: | 45/71 - (63%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 EVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKD--------NTKNNIGMVVIRG 64
::.||:||.:.:|..|||..:|:|:||||.:|:|||.|:|..:| .....:|:||.||
Zfish 14 DLSKYIDKHIRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRG 78
Fly 65 NSIVMV 70
.|:|::
Zfish 79 TSVVLI 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SNRPG | NP_001138209.1 |
Sm_G |
5..74 |
CDD:212466 |
28/71 (39%) |
lsm7 | NP_001041471.1 |
LSm7 |
9..97 |
CDD:212476 |
28/71 (39%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1593201at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.