DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and AT2G14285

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001077889.1 Gene:AT2G14285 / 5007874 AraportID:AT2G14285 Length:61 Species:Arabidopsis thaliana


Alignment Length:45 Identity:14/45 - (31%)
Similarity:24/45 - (53%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEAL 73
            |.|...|.:||:.|.:|.|........|:|.::||.|:::.|..:
plant     5 GFLASVDSYMNLQLGNTEEYIDGQLTGNLGEILIRCNNVLYVRGV 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 14/45 (31%)
AT2G14285NP_001077889.1 Sm_F <1..48 CDD:212469 14/42 (33%)

Return to query results.
Submit another query.