DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and snrpg

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001004660.2 Gene:snrpg / 447922 ZFINID:ZDB-GENE-040912-105 Length:76 Species:Danio rerio


Alignment Length:76 Identity:55/76 - (72%)
Similarity:65/76 - (85%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGN 65
            ||||||||:||:|||::.|||||||.|.|||||||||||:|:|||:|.......|.|||||||||
Zfish     1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVVDDTIEMAPGGQMNTIGMVVIRGN 65

  Fly    66 SIVMVEALDRV 76
            ||:|:|||:||
Zfish    66 SIIMLEALERV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 48/68 (71%)
snrpgNP_001004660.2 Sm_G 5..74 CDD:212466 48/68 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583718
Domainoid 1 1.000 92 1.000 Domainoid score I7638
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37730
Inparanoid 1 1.050 117 1.000 Inparanoid score I4793
OMA 1 1.010 - - QHG53808
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 1 1.000 - - FOG0003135
OrthoInspector 1 1.000 - - oto41616
orthoMCL 1 0.900 - - OOG6_102408
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1275
SonicParanoid 1 1.000 - - X2104
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.