DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and Lsm1

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001102346.1 Gene:Lsm1 / 364624 RGDID:1304967 Length:133 Species:Rattus norvegicus


Alignment Length:65 Identity:24/65 - (36%)
Similarity:38/65 - (58%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTK-NNI--GMVVIRGNSIVMVEALD 74
            :||:.::.|..||.:.|.||..|.|.|:||..|||......| .:|  |:.|:||.::|::..:|
  Rat    14 IDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGRKYGDIPRGIFVVRGENVVLLGEID 78

  Fly    75  74
              Rat    79  78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 23/63 (37%)
Lsm1NP_001102346.1 LSm1 4..77 CDD:212475 23/62 (37%)
PRK10788 <64..131 CDD:182731 5/15 (33%)

Return to query results.
Submit another query.