DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and Lsm7

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:XP_006241020.1 Gene:Lsm7 / 362829 RGDID:1305354 Length:109 Species:Rattus norvegicus


Alignment Length:71 Identity:29/71 - (40%)
Similarity:45/71 - (63%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKD--------NTKNNIGMVVIRG 64
            ::.||:||.:.:|..|||..:|||:||||.:|:|||.|:|..:|        .....:|:||.||
  Rat    20 DLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRG 84

  Fly    65 NSIVMV 70
            .|:|::
  Rat    85 TSVVLI 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 29/71 (41%)
Lsm7XP_006241020.1 LSm7 17..103 CDD:212476 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.