DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and LSm7

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_609807.1 Gene:LSm7 / 35003 FlyBaseID:FBgn0261068 Length:110 Species:Drosophila melanogaster


Alignment Length:78 Identity:28/78 - (35%)
Similarity:51/78 - (65%) Gaps:9/78 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTK---------NNIGMVVIR 63
            ::.||::|::.:|..|||..:|||:|:|..:|:|||:|||..:|:.:         .::|:||.|
  Fly    23 DLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCR 87

  Fly    64 GNSIVMVEALDRV 76
            |.::|::...|.|
  Fly    88 GTALVLICPQDGV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 26/74 (35%)
LSm7NP_609807.1 LSm7 18..107 CDD:212476 28/78 (36%)

Return to query results.
Submit another query.