DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and smg1

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_596422.1 Gene:smg1 / 2540855 PomBaseID:SPBC4B4.05 Length:77 Species:Schizosaccharomyces pombe


Alignment Length:76 Identity:40/76 - (52%)
Similarity:60/76 - (78%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGN 65
            ||||..|::|||:|:::.::|||.|.|.|:|||:|.|:|:||:|::||..|..|..||.|.||||
pombe     1 MSKAGAPDLKKYLDRQVFVQLNGSRKVYGVLRGYDIFLNIVLEDSIEEKVDGEKVKIGSVAIRGN 65

  Fly    66 SIVMVEALDRV 76
            |::|:|.||::
pombe    66 SVIMIETLDKM 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 34/68 (50%)
smg1NP_596422.1 Sm_G 5..74 CDD:212466 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I2405
eggNOG 1 0.900 - - E1_KOG1780
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I1739
OMA 1 1.010 - - QHG53808
OrthoFinder 1 1.000 - - FOG0003135
OrthoInspector 1 1.000 - - oto101357
orthoMCL 1 0.900 - - OOG6_102408
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1275
SonicParanoid 1 1.000 - - X2104
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.