DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and LSM5

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_036454.1 Gene:LSM5 / 23658 HGNCID:17162 Length:91 Species:Homo sapiens


Alignment Length:67 Identity:21/67 - (31%)
Similarity:37/67 - (55%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVE-----ECKDNTKNNIGMVVIRGNSIV 68
            |.|.:..|:.:.:...:.:.|.|.|||.|:|:||:|..|     |.:..||  :..:::.||:|.
Human    18 VDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITK--LDQILLNGNNIT 80

  Fly    69 MV 70
            |:
Human    81 ML 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 21/67 (31%)
LSM5NP_036454.1 LSm5 11..86 CDD:212479 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.