powered by:
Protein Alignment SNRPG and LSM5
DIOPT Version :9
Sequence 1: | NP_001138209.1 |
Gene: | SNRPG / 32636 |
FlyBaseID: | FBgn0261791 |
Length: | 76 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_036454.1 |
Gene: | LSM5 / 23658 |
HGNCID: | 17162 |
Length: | 91 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 21/67 - (31%) |
Similarity: | 37/67 - (55%) |
Gaps: | 7/67 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 VKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVE-----ECKDNTKNNIGMVVIRGNSIV 68
|.|.:..|:.:.:...:.:.|.|.|||.|:|:||:|..| |.:..|| :..:::.||:|.
Human 18 VDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITK--LDQILLNGNNIT 80
Fly 69 MV 70
|:
Human 81 ML 82
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SNRPG | NP_001138209.1 |
Sm_G |
5..74 |
CDD:212466 |
21/67 (31%) |
LSM5 | NP_036454.1 |
LSm5 |
11..86 |
CDD:212479 |
21/67 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.