DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and Snrpe

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_033253.1 Gene:Snrpe / 20643 MGIID:98346 Length:92 Species:Mus musculus


Alignment Length:68 Identity:17/68 - (25%)
Similarity:40/68 - (58%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYMDKRMMLKL----NGGRAVTGILRGFDPFMNVVLDDTVE-ECKDNTKNNIGMVVIRGNSIVMV 70
            :|:..|..:::    .....:.|.:.|||.:||:||||..| ..|..::..:|.::::|::|.::
Mouse    23 RYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLL 87

  Fly    71 EAL 73
            :::
Mouse    88 QSV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 17/68 (25%)
SnrpeNP_033253.1 Sm_E 11..89 CDD:212465 17/65 (26%)

Return to query results.
Submit another query.