DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and lsm-7

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_502034.1 Gene:lsm-7 / 177988 WormBaseID:WBGene00003081 Length:104 Species:Caenorhabditis elegans


Alignment Length:75 Identity:26/75 - (34%)
Similarity:44/75 - (58%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKD--------NTKNNIGMVVIRG 64
            ::.:::||.:.:|..|||..:|:|||||..:|:||||..|..:|        :....:|::|.||
 Worm    15 DLTRFLDKEIRVKFQGGREASGVLRGFDQLLNMVLDDCREYLRDPQNPSVVGDETRQLGLIVARG 79

  Fly    65 NSIVMVEALD 74
            .:|.:|...|
 Worm    80 TAITVVSPAD 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 25/73 (34%)
lsm-7NP_502034.1 LSm7 10..98 CDD:212476 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.