DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and snr-7

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_491032.1 Gene:snr-7 / 171834 WormBaseID:WBGene00004920 Length:77 Species:Caenorhabditis elegans


Alignment Length:76 Identity:50/76 - (65%)
Similarity:61/76 - (80%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGN 65
            |||.||||:||||||.|.|||||.|.|:|||||||||||:|:|:.||..||....|:||.|||||
 Worm     1 MSKTHPPELKKYMDKEMDLKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKDGGSVNLGMTVIRGN 65

  Fly    66 SIVMVEALDRV 76
            |:|::|..:|:
 Worm    66 SVVIMEPKERI 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 46/68 (68%)
snr-7NP_491032.1 Sm_G 5..74 CDD:212466 46/68 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I5005
eggNOG 1 0.900 - - E1_KOG1780
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37730
Inparanoid 1 1.050 107 1.000 Inparanoid score I3499
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53808
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 1 1.000 - - FOG0003135
OrthoInspector 1 1.000 - - oto19473
orthoMCL 1 0.900 - - OOG6_102408
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1275
SonicParanoid 1 1.000 - - X2104
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.910

Return to query results.
Submit another query.