DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and LSm7

DIOPT Version :10

Sequence 1:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:XP_317337.4 Gene:LSm7 / 1277833 VectorBaseID:AGAMI1_012900 Length:126 Species:Anopheles gambiae


Alignment Length:70 Identity:26/70 - (37%)
Similarity:47/70 - (67%) Gaps:7/70 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKD-------NTKNNIGMVVIRGN 65
            ::.||::|.:.:|..|||...|:|:|:||.:|:|||:|:|..:|       :...::|:||.||.
Mosquito    39 DLSKYLEKTIRVKFAGGREAAGVLKGYDPLLNLVLDNTIEFLRDPDDYKLADDTRHLGLVVCRGT 103

  Fly    66 SIVMV 70
            |:|::
Mosquito   104 SVVLI 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 26/70 (37%)
LSm7XP_317337.4 None

Return to query results.
Submit another query.