DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and lsm7

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:XP_017951866.1 Gene:lsm7 / 100127774 XenbaseID:XB-GENE-1008123 Length:125 Species:Xenopus tropicalis


Alignment Length:71 Identity:28/71 - (39%)
Similarity:45/71 - (63%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKD--------NTKNNIGMVVIRG 64
            ::.||:||.:.:|..|||..:|:|:||||.:|:|||.|:|..:|        .....:|:||.||
 Frog    36 DLSKYIDKAIRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRG 100

  Fly    65 NSIVMV 70
            .|:|::
 Frog   101 TSVVLI 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 28/71 (39%)
lsm7XP_017951866.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.