DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and snrpg

DIOPT Version :9

Sequence 1:NP_001138209.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001165120.1 Gene:snrpg / 100125174 XenbaseID:XB-GENE-5874501 Length:76 Species:Xenopus tropicalis


Alignment Length:76 Identity:53/76 - (69%)
Similarity:64/76 - (84%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGN 65
            ||||||||:||:|||::.|||||||.|.|||||||||||:|:|:..|......:|.|||||||||
 Frog     1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECTEISGGGHQNTIGMVVIRGN 65

  Fly    66 SIVMVEALDRV 76
            ||:|:|||:||
 Frog    66 SIIMLEALERV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001138209.1 Sm_G 5..74 CDD:212466 46/68 (68%)
snrpgNP_001165120.1 Sm_G 5..74 CDD:212466 46/68 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7902
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37730
Inparanoid 1 1.050 112 1.000 Inparanoid score I4725
OMA 1 1.010 - - QHG53808
OrthoDB 1 1.010 - - D1593201at2759
OrthoFinder 1 1.000 - - FOG0003135
OrthoInspector 1 1.000 - - oto103983
Panther 1 1.100 - - LDO PTHR10553
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1275
SonicParanoid 1 1.000 - - X2104
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.