DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and RPS19B

DIOPT Version :9

Sequence 1:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_014097.1 Gene:RPS19B / 855414 SGDID:S000005246 Length:144 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:68/138 - (49%)
Similarity:86/138 - (62%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPD-WFYVRCASILRHL 64
            |.||:|:|:.......|.|.||::.|||:||..:|||||:...|:.|.|.: |||.|.||:.||:
Yeast     1 MAGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAEGWFYKRAASVARHI 65

  Fly    65 YHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQR 129
            |.|...|||.:.|:|||.|..||.|.....|:....||.|||||...:||..|.|||::|..|||
Yeast    66 YMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSINRKVLQALEKIGIVEISPKGGRRISENGQR 130

  Fly   130 DLDRIANQ 137
            ||||||.|
Yeast   131 DLDRIAAQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 65/134 (49%)
RPS19BNP_014097.1 Ribosomal_S19e 5..142 CDD:395866 65/134 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344770
Domainoid 1 1.000 124 1.000 Domainoid score I1201
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130609
Inparanoid 1 1.050 133 1.000 Inparanoid score I1227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62169
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm9212
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - LDO PTHR11710
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2775
SonicParanoid 1 1.000 - - X617
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.