DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and AT5G61170

DIOPT Version :9

Sequence 1:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_200925.1 Gene:AT5G61170 / 836238 AraportID:AT5G61170 Length:143 Species:Arabidopsis thaliana


Alignment Length:136 Identity:72/136 - (52%)
Similarity:95/136 - (69%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLYHR 67
            |.||||:..|...||.|..||::||:::|...|||||.|.||||||||||:|:|.||:.|.:|.|
plant     4 GKTVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLR 68

  Fly    68 SPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRDLD 132
            ...|||:..:||||.||||..|.|||:::.|.||..||.|:...:|:....||||::|.||||||
plant    69 GGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKGGRKITSSGQRDLD 133

  Fly   133 RIANQI 138
            ::|.:|
plant   134 QVAGRI 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 70/132 (53%)
AT5G61170NP_200925.1 Ribosomal_S19e 6..142 CDD:395866 71/134 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 154 1.000 Domainoid score I1350
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1675
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm1074
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - LDO PTHR11710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.