DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and RpS19b

DIOPT Version :9

Sequence 1:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001262891.1 Gene:RpS19b / 42830 FlyBaseID:FBgn0039129 Length:155 Species:Drosophila melanogaster


Alignment Length:153 Identity:102/153 - (66%)
Similarity:122/153 - (79%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLY 65
            |||||||:||||.:||.:|.||||:||:.||:|...:||.||||.||.|.||||.|||||:||||
  Fly     1 MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLY 65

  Fly    66 HRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRD 130
            .|||||||:.||:|.|||||||.||..||::||..||||||||.|.:||:||||||||:..|||:
  Fly    66 LRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQGQRN 130

  Fly   131 LDRIANQIVFKQRDAAKQTGPIV 153
            ||||||:||.|||:.:.....|:
  Fly   131 LDRIANKIVAKQRERSAPVSMII 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 92/132 (70%)
RpS19bNP_001262891.1 Ribosomal_S19e 5..138 CDD:279436 92/132 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456828
Domainoid 1 1.000 154 1.000 Domainoid score I1350
eggNOG 1 0.900 - - E1_COG2238
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1675
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - otm25170
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - P PTHR11710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X617
1211.810

Return to query results.
Submit another query.