DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and rps19

DIOPT Version :9

Sequence 1:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_957044.1 Gene:rps19 / 393723 ZFINID:ZDB-GENE-040426-1716 Length:146 Species:Danio rerio


Alignment Length:139 Identity:90/139 - (64%)
Similarity:107/139 - (76%) Gaps:1/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-GVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHL 64
            || ||||||::|....:|:|.||||:|||||||.:||||.||.|||||.|.:|||:|.||.:|||
Zfish     1 MPGGVTVKDVNQQEFVRALAAFLKKSGKLKVPDWVDIVKLAKHKELAPCDENWFYIRAASTVRHL 65

  Fly    65 YHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQR 129
            |.|...||||:||||||||||||.||||...:...|||.|||||..::|||.|:|||:|:..|.|
Zfish    66 YLRGGVGVGSMTKIYGGRKRNGVCPSHFSVGSKNVARKVLQALEGLKMVEKDPNGGRRLTPQGTR 130

  Fly   130 DLDRIANQI 138
            ||||||.|:
Zfish   131 DLDRIAGQV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 85/132 (64%)
rps19NP_957044.1 Ribosomal_S19e 6..139 CDD:279436 85/132 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 175 1.000 Domainoid score I3594
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I4008
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - otm25170
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - LDO PTHR11710
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2775
SonicParanoid 1 1.000 - - X617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.970

Return to query results.
Submit another query.