DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and RGD1559724

DIOPT Version :9

Sequence 1:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_038934096.1 Gene:RGD1559724 / 299021 RGDID:1559724 Length:159 Species:Rattus norvegicus


Alignment Length:131 Identity:71/131 - (54%)
Similarity:88/131 - (67%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLYHRSPAGV 72
            |::|....:|:|.||.|:||||||..:||||.||.||..||. :|||.|.||..|:||.|..|.|
  Rat    23 DVNQQEFVRALAAFLTKSGKLKVPAWVDIVKLAKHKEFTPYG-NWFYTRVASTARYLYLRGGAAV 86

  Fly    73 GSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRDLDRIANQ 137
            ..:|||||||.|:||.||||.|.....||..|||||..:::||..||||||:...|:|||.:|.|
  Rat    87 DFMTKIYGGRLRHGVKPSHFSRGFKNVARGVLQALEGLKMMEKDQDGGRKLTPQEQKDLDGMAGQ 151

  Fly   138 I 138
            :
  Rat   152 V 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 70/129 (54%)
RGD1559724XP_038934096.1 Ribosomal_S19e 23..154 CDD:395866 71/131 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11710
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.