DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and rps1901

DIOPT Version :9

Sequence 1:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_596593.1 Gene:rps1901 / 2540447 PomBaseID:SPBC21C3.13 Length:144 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:70/144 - (48%)
Similarity:95/144 - (65%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLY 65
            |.||:|||:|......|.|.|||::||:..|..:|||||...||||||||||:|||.|:|.||:|
pombe     1 MAGVSVKDVDAQKFITAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDPDWYYVRAAAIARHIY 65

  Fly    66 HRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRD 130
            .|...|||.:.|:|||....|:.|||....:....||.:|:||...::||..:|||::|..||||
pombe    66 LRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIGVLEKSDNGGRRISQQGQRD 130

  Fly   131 LDRIANQIVFKQRD 144
            |||||..::.::.:
pombe   131 LDRIAYSLLEEESE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 67/132 (51%)
rps1901NP_596593.1 Ribosomal_S19e 5..138 CDD:279436 67/132 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1166
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130609
Inparanoid 1 1.050 148 1.000 Inparanoid score I1319
OMA 1 1.010 - - QHG62169
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - mtm9295
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - LDO PTHR11710
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2775
SonicParanoid 1 1.000 - - X617
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.