DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and rps1901

DIOPT Version :10

Sequence 1:NP_523376.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_596593.1 Gene:rps1901 / 2540447 PomBaseID:SPBC21C3.13 Length:144 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:70/144 - (48%)
Similarity:95/144 - (65%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLY 65
            |.||:|||:|......|.|.|||::||:..|..:|||||...||||||||||:|||.|:|.||:|
pombe     1 MAGVSVKDVDAQKFITAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDPDWYYVRAAAIARHIY 65

  Fly    66 HRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRD 130
            .|...|||.:.|:|||....|:.|||....:....||.:|:||...::||..:|||::|..||||
pombe    66 LRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIGVLEKSDNGGRRISQQGQRD 130

  Fly   131 LDRIANQIVFKQRD 144
            |||||..::.::.:
pombe   131 LDRIAYSLLEEESE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_523376.1 Ribosomal_S19e 5..139 CDD:460058 67/133 (50%)
rps1901NP_596593.1 Ribosomal_S19e 5..141 CDD:460058 67/135 (50%)

Return to query results.
Submit another query.