DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS19a and rps-19

DIOPT Version :9

Sequence 1:NP_001285338.1 Gene:RpS19a / 32635 FlyBaseID:FBgn0010412 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001366893.1 Gene:rps-19 / 172805 WormBaseID:WBGene00004488 Length:146 Species:Caenorhabditis elegans


Alignment Length:145 Identity:81/145 - (55%)
Similarity:103/145 - (71%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLYHRSP 69
            ::||:|||..||::|.||||:||:|||:..|:||....|||||.||||||.|.||:.||||.| |
 Worm     6 SIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDPDWFYTRAASLARHLYFR-P 69

  Fly    70 AGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDG-GRKLSSIGQRDLDR 133
            ||:|:..|:|||.||.||.|:||..:|....|||:|.||..:.||||||| ||.||..|::||||
 Worm    70 AGIGAFKKVYGGNKRRGVAPNHFQTSAGNCLRKAVQQLEKIKWVEKHPDGKGRILSKQGRKDLDR 134

  Fly   134 IANQIVFKQRDAAKQ 148
            ||..:    |.:.:|
 Worm   135 IATSL----RSSGQQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS19aNP_001285338.1 Ribosomal_S19e 5..138 CDD:279436 79/133 (59%)
rps-19NP_001366893.1 Ribosomal_S19e 6..139 CDD:395866 79/133 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162437
Domainoid 1 1.000 161 1.000 Domainoid score I2443
eggNOG 1 0.900 - - E1_COG2238
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130609
Inparanoid 1 1.050 161 1.000 Inparanoid score I2854
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62169
OrthoDB 1 1.010 - - D1434984at2759
OrthoFinder 1 1.000 - - FOG0001026
OrthoInspector 1 1.000 - - otm14233
orthoMCL 1 0.900 - - OOG6_100904
Panther 1 1.100 - - LDO PTHR11710
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2775
SonicParanoid 1 1.000 - - X617
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.