DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and TAOK2

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_011544284.1 Gene:TAOK2 / 9344 HGNCID:16835 Length:1242 Species:Homo sapiens


Alignment Length:311 Identity:109/311 - (35%)
Similarity:162/311 - (52%) Gaps:22/311 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 SGGAAGQPKQDQRLTHEQFRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVK 397
            :||.||..| |..:....|:         .||.:......:||.||.|.|..|.|......||:|
Human     3 AGGRAGSLK-DPDVAELFFK---------DDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIK 57

  Fly   398 KMDLRKQQRREL---LFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTHSR- 458
            ||....:|..|.   :..||..::...|||.::....:|.....|:||||..|.|...:..|.: 
Human    58 KMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKP 122

  Fly   459 MDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLV 523
            :.|.:||.|....|:.||||||..:||||:|:.:|||:..|.|||.|||..:.::    ...|.|
Human   123 LQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMA----PANSFV 183

  Fly   524 GTPYWMSPEVISRL---PYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNA 585
            ||||||:||||..:   .|..:||:|||||..||:.:.:||.||...:.|:..|...:.|.|::.
Human   184 GTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPVLQSG 248

  Fly   586 HKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQAGPPSLLVPLMRNAR 636
            | .|...::|:|..|.:.|..|.|:..||.|.|:.:..||::::.|::..:
Human   249 H-WSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 99/266 (37%)
S_TKc 372..619 CDD:214567 96/253 (38%)
TAOK2XP_011544284.1 STKc_TAO2 12..319 CDD:270804 104/301 (35%)
S_TKc 28..281 CDD:214567 96/257 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.