DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and MAP4K3

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_003609.2 Gene:MAP4K3 / 8491 HGNCID:6865 Length:894 Species:Homo sapiens


Alignment Length:281 Identity:112/281 - (39%)
Similarity:173/281 - (61%) Gaps:8/281 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 VSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHP 423
            :|..:|:|:.:...:||.|:.|.|..|.:.:||...|:|.:.|...:...::..|:::|:|..||
Human     7 LSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHP 71

  Fly   424 NIVETYSSFLVNDELWVVMEYLEGGALTDI--VTHSRMDEEQIATVCKQCLKALAYLHSQGVIHR 486
            |||..:.|:|..|:||:.||:..||:|.||  || ..:.|.|||.|.::.|:.|.||||:|.:||
Human    72 NIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVT-GPLSELQIAYVSRETLQGLYYLHSKGKMHR 135

  Fly   487 DIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVIS---RLPYGPEVDIWSL 548
            |||..:|||..:|.|||:|||..||::..:.||||.:||||||:|||.:   :..|....|:|::
Human   136 DIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAV 200

  Fly   549 GIMVIEMVDGEPPFFNEPPLQAMRRI--RDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAA 611
            ||..||:.:.:||.|:..|::|:..:  .:.|||.||:..|.|.....|:...|.::|.:|.||.
Human   201 GITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAE 265

  Fly   612 ELLAHPFLRQAGPPSLLVPLM 632
            :||.|||:.|....||.:.|:
Human   266 KLLQHPFVTQHLTRSLAIELL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 108/266 (41%)
S_TKc 372..619 CDD:214567 104/253 (41%)
MAP4K3NP_003609.2 STKc_MAP4K3_like 15..273 CDD:270788 104/258 (40%)
S_TKc 16..273 CDD:214567 104/257 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..536
CNH 561..874 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.