DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and STK24

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_016876283.1 Gene:STK24 / 8428 HGNCID:11403 Length:517 Species:Homo sapiens


Alignment Length:313 Identity:119/313 - (38%)
Similarity:175/313 - (55%) Gaps:18/313 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 GASGGAAGQPKQDQR---------LTHEQFRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIAT 386
            |.:||..||....:|         :...::|..|:     .||.|......|||:||.|.|....
Human    69 GQAGGRPGQGGDGERAWTRPGPSGVGRVEWRKNLK-----ADPEELFTKLEKIGKGSFGEVFKGI 128

  Fly   387 DKSTGRQVAVKKMDLRK-QQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGAL 450
            |..|.:.||:|.:||.: :...|.:..|:.::.....|.:.:.|.|:|.:.:||::||||.||:.
Human   129 DNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSA 193

  Fly   451 TDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQE 515
            .|::....:||.||||:.::.||.|.||||:..||||||:.::||:..|.|||:|||...|::..
Human   194 LDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDT 258

  Fly   516 LPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPP 580
            ..||.:.||||:||:||||.:..|..:.|||||||..||:..||||.....|::.:..|....||
Human   259 QIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPP 323

  Fly   581 NLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPF-LRQAGPPSLLVPLM 632
            .|:..:  |..|:.|::..|.::|:.|.||.|||.|.| ||.|...|.|..|:
Human   324 TLEGNY--SKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 105/261 (40%)
S_TKc 372..619 CDD:214567 102/248 (41%)
STK24XP_016876283.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.