DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and MAPKKK18

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_172003.1 Gene:MAPKKK18 / 839324 AraportID:AT1G05100 Length:339 Species:Arabidopsis thaliana


Alignment Length:280 Identity:92/280 - (32%)
Similarity:142/280 - (50%) Gaps:28/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVE------TYSSF 432
            :|.|||.||..||...:|..:|||..:.   .|.|.|..|..|:...:.|.::.      |...|
plant     9 LGRGSTATVSAATCHESGETLAVKSAEF---HRSEFLQREAKILSSLNSPYVIGYRGCEITREPF 70

  Fly   433 LVNDELW---VVMEYLEGGALTDIVTHSR--MDEEQIATVCKQCLKALAYLH-SQGVIHRDIKSD 491
            ..|.|..   ::|||...|.|||:.|.:.  :||.::....:|.|..|.|:| |:|:.|.|||..
plant    71 HNNGEATTYSLLMEYAPYGTLTDVATKNGGFIDEARVVKYTRQILLGLEYIHNSKGIAHCDIKGS 135

  Fly   492 SILLAADGRVKLSDFGFCAQVSQEL--PKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIE 554
            ::|:..:|..|::|||....|..|:  |.|    |||.:|:||.......|.|.|||::|..|||
plant   136 NVLVGENGEAKIADFGCAKWVEPEITEPVR----GTPAFMAPEAARGERQGKESDIWAVGCTVIE 196

  Fly   555 MVDGEPPFFN---EPPLQAMRRIRDM-QPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLA 615
            ||.|..|:..   ..|:..:.|:..: :.|.|..:  ::.:.:.||.:.|.::..:|.||::||.
plant   197 MVTGSQPWIGADFTDPVSVLYRVGYLGELPELPCS--LTEQAKDFLGKCLKKEATERWTASQLLN 259

  Fly   616 HPFLRQAGPPSLLVPLMRNA 635
            ||||... .|.|:..|:.|:
plant   260 HPFLVNK-EPELVTGLVTNS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 87/263 (33%)
S_TKc 372..619 CDD:214567 86/262 (33%)
MAPKKK18NP_172003.1 STKc_MAPKKK 2..263 CDD:270783 86/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.