DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and NP1

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_563832.2 Gene:NP1 / 837421 AraportID:AT1G09000 Length:666 Species:Arabidopsis thaliana


Alignment Length:273 Identity:91/273 - (33%)
Similarity:141/273 - (51%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IGEGSTGTVCIATDKSTGRQVAVKKMDL--------RKQQRRELLFNEVVIMRDYHHPNIVETYS 430
            ||.|:.|||.:..:..:|..:|||::.:        :.|...:.|..||.::::..|||||....
plant    75 IGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLG 139

  Fly   431 SFLVNDELWVVMEYLEGGALTDIV-THSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSIL 494
            :...:|.|.:::|::.||:::.:: ......|..:.|..:|.|..|.|||:..::|||||..:||
plant   140 TVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDIKGANIL 204

  Fly   495 LAADGRVKLSDFGFCAQVSQ--ELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVD 557
            :...|.:||:|||...||::  .:...||:.||||||:||||.:..:....||||:|..|||||.
plant   205 VDNKGCIKLADFGASKQVAELATMTGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVT 269

  Fly   558 GEPP-----------FF-----NEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQ 606
            |:.|           ||     :.||:          |..|.:..|      .||.:.|...|..
plant   270 GKAPWSQQYKEVAAIFFIGTTKSHPPI----------PDTLSSDAK------DFLLKCLQEVPNL 318

  Fly   607 RATAAELLAHPFL 619
            |.||:|||.|||:
plant   319 RPTASELLKHPFV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 91/273 (33%)
S_TKc 372..619 CDD:214567 90/271 (33%)
NP1NP_563832.2 STKc_MAPKKK 68..331 CDD:270783 90/271 (33%)
S_TKc 69..331 CDD:214567 90/271 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.