DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and MAPKKK15

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001330365.1 Gene:MAPKKK15 / 835600 AraportID:AT5G55090 Length:510 Species:Arabidopsis thaliana


Alignment Length:269 Identity:89/269 - (33%)
Similarity:128/269 - (47%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLV--ND 436
            ||.|||.||.:....| |...|||..:....   ..|..|..|:.....|.||:...|.:.  ||
plant    74 IGRGSTATVSLGITNS-GDFFAVKSAEFSSS---AFLQREQSILSKLSSPYIVKYIGSNVTKEND 134

  Fly   437 ELW--VVMEYLEGGALTDIVTHS--RMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAA 497
            :|.  ::|||:.||:|.|::.:|  ::.|..|.:..:|.||.|.|||.||::|.|:||.::::..
plant   135 KLMYNLLMEYVSGGSLHDLIKNSGGKLPEPLIRSYTRQILKGLMYLHDQGIVHCDVKSQNVMIGG 199

  Fly   498 DGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPF 562
            : ..|:.|.| ||:..:| .:.....|||.:|||||..........|:|:||..||||..|..|:
plant   200 E-IAKIVDLG-CAKTVEE-NENLEFSGTPAFMSPEVARGEEQSFPADVWALGCTVIEMATGSSPW 261

  Fly   563 FNEPPLQAMRRIRDMQPPNLKNA----HKV-------------SPRLQSFLDRMLVRDPAQRATA 610
                             |.|.:.    :|:             |.:.|.||.:.|.:||.||.|.
plant   262 -----------------PELNDVVAAIYKIGFTGESPVIPVWLSEKGQDFLRKCLRKDPKQRWTV 309

  Fly   611 AELLAHPFL 619
            .|||.||||
plant   310 EELLQHPFL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 89/269 (33%)
S_TKc 372..619 CDD:214567 87/267 (33%)
MAPKKK15NP_001330365.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.