DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and AT3G15220

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_188140.1 Gene:AT3G15220 / 820753 AraportID:AT3G15220 Length:690 Species:Arabidopsis thaliana


Alignment Length:280 Identity:110/280 - (39%)
Similarity:168/280 - (60%) Gaps:11/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 AALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRR-ELLFNEVVI 416
            |.||....|     .......||.||.|.|..|.||...::||:|.:||.:.:.. |.:..|:.:
plant     5 AGLQEAAGA-----RFSQIELIGRGSFGDVYKAFDKDLNKEVAIKVIDLEESEDEIEDIQKEISV 64

  Fly   417 MRDYHHPNIVETYSSFLVNDELWVVMEYLEGGALTDIV-THSRMDEEQIATVCKQCLKALAYLHS 480
            :.....|.|.|.|.|:|...:||::|||:.||::.|:: :::.:||..||.:.:..|.|:.|||:
plant    65 LSQCRCPYITEYYGSYLHQTKLWIIMEYMAGGSVADLLQSNNPLDETSIACITRDLLHAVEYLHN 129

  Fly   481 QGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLP-YGPEVD 544
            :|.||||||:.:|||:.:|.||::|||..||:::.:.:||:.||||:||:||||.... |..:.|
plant   130 EGKIHRDIKAANILLSENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAPEVIQNSEGYNEKAD 194

  Fly   545 IWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRAT 609
            ||||||.||||..||||..:..|::.:..|....||.| :.| .|.:::.|:...|.:.||:|.:
plant   195 IWSLGITVIEMAKGEPPLADLHPMRVLFIIPRETPPQL-DEH-FSRQVKEFVSLCLKKAPAERPS 257

  Fly   610 AAELLAHPFLRQA-GPPSLL 628
            |.||:.|.|::.| ..|.||
plant   258 AKELIKHRFIKNARKSPKLL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 103/262 (39%)
S_TKc 372..619 CDD:214567 101/249 (41%)
AT3G15220NP_188140.1 STKc_MST3_like 14..287 CDD:270786 106/266 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.