DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbt and MAPKKK6

DIOPT Version :9

Sequence 1:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_187455.1 Gene:MAPKKK6 / 819989 AraportID:AT3G07980 Length:1367 Species:Arabidopsis thaliana


Alignment Length:279 Identity:100/279 - (35%)
Similarity:155/279 - (55%) Gaps:13/279 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 ALQMVVSAGDPRENLDH----FNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRK--QQRRELLFN 412
            |.||..|.....:.||:    .::||:|:.|.|.|..|...|..||:|::.|..  |:....:..
plant     2 ARQMTSSQFHKSKTLDNKYMLGDEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLNTIMQ 66

  Fly   413 EVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTHSRMD--EEQIATV-CKQCLKA 474
            |:.::::.:|.|||:...|......|.:::||:|.|:|.:|:..::..  .|.:.|| ..|.|:.
plant    67 EIDLLKNLNHKNIVKYLGSLKTKTHLHIILEYVENGSLANIIKPNKFGPFPESLVTVYIAQVLEG 131

  Fly   475 LAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPY 539
            |.|||.|||||||||..:||...:|.|||:|||...::::......|:|||||||:||||.....
plant   132 LVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLNEADFNTHSVVGTPYWMAPEVIELSGV 196

  Fly   540 GPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRI-RDMQPPNLKNAHKVSPRLQSFLDRMLVRD 603
            ....||||:|..:||::...||:::..|:.|:.|| :|..||   ....:||.:..||.....:|
plant   197 CAASDIWSVGCTIIELLTCVPPYYDLQPMPALYRIVQDDTPP---IPDSLSPDITDFLRLCFKKD 258

  Fly   604 PAQRATAAELLAHPFLRQA 622
            ..||..|..||:||::|.:
plant   259 SRQRPDAKTLLSHPWIRNS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 96/269 (36%)
S_TKc 372..619 CDD:214567 93/252 (37%)
MAPKKK6NP_187455.1 STKc_Cdc7_like 19..274 CDD:270797 93/257 (36%)
S_TKc 20..274 CDD:214567 93/256 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.